PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000690168
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 352aa    MW: 38853.6 Da    PI: 9.1468
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000690168genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.56.1e-5491361128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhP+deel+++yL +k+++ +++  ++i++vd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++ 
  MDP0000690168   9 LPPGFRFHPSDEELITFYLMNKINDATFTG-RAIADVDLNKCEPWELPAKAKMGEKEWYFFSLRDRKYPTGVRTNRATSTGYWKTTGKDKEIFNSv 103
                    79*************************999.89***************99999****************************************998 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++el g+kktLvfy+grap+gek++Wvmheyr+
  MDP0000690168 104 TSELFGMKKTLVFYRGRAPRGEKSNWVMHEYRI 136
                    9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-626157IPR003441NAC domain
PROSITE profilePS5100559.5679157IPR003441NAC domain
PfamPF023651.2E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MTAEPKEELP PGFRFHPSDE ELITFYLMNK INDATFTGRA IADVDLNKCE PWELPAKAKM  60
GEKEWYFFSL RDRKYPTGVR TNRATSTGYW KTTGKDKEIF NSVTSELFGM KKTLVFYRGR  120
APRGEKSNWV MHEYRIHSKS GFRTSKDEWV VCRVFQKSAG IKKYPTNQSR AANPYNLEIG  180
PSMVPSPLMQ LGDPNHHQFP YGRNYMTSAE MAELSRVFRG GGGGGGGSSS SNINLPIQHQ  240
FNYPIGGGGG GGGVGGGAGG FTMSGLNLNL GGPASQPMLR TMPPPQMHHH GPPSMNHHHQ  300
VQDVTMMNGP DHQAGYGTID MNNSNNANGG SGNRFMNMDT CVDLENYWPP Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-53916317171NAC domain-containing protein 19
4dul_A5e-53916317171NAC domain-containing protein 19
1ut7_B5e-53916317171NO APICAL MERISTEM PROTEIN
1ut7_A5e-53916317171NO APICAL MERISTEM PROTEIN
1ut4_B5e-53916317171NO APICAL MERISTEM PROTEIN
1ut4_A5e-53916317171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008378121.10.0PREDICTED: NAC domain-containing protein 100-like isoform X2
TrEMBLM5XQA30.0M5XQA3_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g02710.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-103NAC domain containing protein 38